PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG213500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 276aa    MW: 31203.9 Da    PI: 5.493
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG213500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB72.75.9e-231193385
                NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                         ++d  lP + + +i+k++lP + ++++da++++ ec +efi +++se+++ c re++kti+++ +l al++lGf +y++++ +
  Pavir.6NG213500.1.p 11 KEDVSLPKSTMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSREEKKTIAPEHVLKALSDLGFREYIDEVYA 93
                         67999**************************************************************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-378139IPR009072Histone-fold
SuperFamilySSF471132.51E-3412139IPR009072Histone-fold
PfamPF008085.9E-201579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLLSSESNE  60
VCSREEKKTI APEHVLKALS DLGFREYIDE VYAAYEQHKL DTLDSPKASK FTGIEMTEEE  120
AVAEQQRMFA EARARMNNGT PKPKEPEQEQ QQQPHPQLQL HTTPQQPMQP QLQLHPQPQK  180
HPQVQLHSQS QQPHVQPQQP TQVQLHSQPQ QAPQVQLHPQ RQQPPQAPPH PSPEQSSQPE  240
PQVHLQSQEP PQAQLQPHLQ AQPQPQAQTE HGGDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-331213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.21600.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359460.0BT035946.1 Zea mays full-length cDNA clone ZM_BFb0089E11 mRNA, complete cds.
GenBankHQ8587550.0HQ858755.1 Zea mays clone UT1497 CCAAT1-Dr1 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973302.11e-116PREDICTED: protein Dr1 homolog
SwissprotP495921e-80NC2B_ARATH; Protein Dr1 homolog
TrEMBLK3YIU01e-116K3YIU0_SETIT; Uncharacterized protein
STRINGSi014159m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.43e-79nuclear factor Y, subunit B13